PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D00116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25723.1 Da    PI: 9.2125
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D00116.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.4e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
  Pahal.D00116.1  9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
                    79***********************************************96 PP

2K-box86.36.3e-2971168198
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+sL++ eL+ Leq+++ +lk++R +K++++ +q+++ +kk k   e+ k+L+
  Pahal.D00116.1  71 YQQAIGTSLWVEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFDELRGLEQNVDAALKEVRHRKYHVISTQTDTYKKKVKHSYEAYKNLQ 165
                     67888999*************************************************************************************** PP

           K-box  96 kkl 98 
                     ++l
  Pahal.D00116.1 166 QEL 168
                     986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.59161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-36295IPR002100Transcription factor, MADS-box
CDDcd002651.66E-43280No hitNo description
PRINTSPR004042.3E-28323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-283859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-2282168IPR002487Transcription factor, K-box
PROSITE profilePS5129715.23884174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP  60
GTDIKTIFDR YQQAIGTSLW VEQYENMQRT LSHLKDINRN LRTEIRQRMG EDLDSLEFDE  120
LRGLEQNVDA ALKEVRHRKY HVISTQTDTY KKKVKHSYEA YKNLQQELGM REDPAFGFVD  180
NTGAGGWDGA VALGGPGAAD MYAFRVVPSQ PNLHGMAYGS HDLRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-16273170Myocyte-specific enhancer factor 2A
3p57_I2e-16273170Myocyte-specific enhancer factor 2A
3p57_D2e-16273170Myocyte-specific enhancer factor 2A
3p57_C2e-16273170Myocyte-specific enhancer factor 2A
3p57_B2e-16273170Myocyte-specific enhancer factor 2A
3p57_A2e-16273170Myocyte-specific enhancer factor 2A
3kov_J2e-16273170Myocyte-specific enhancer factor 2A
3kov_I2e-16273170Myocyte-specific enhancer factor 2A
3kov_B2e-16273170Myocyte-specific enhancer factor 2A
3kov_A2e-16273170Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0399880.0BT039988.1 Zea mays full-length cDNA clone ZM_BFc0056L03 mRNA, complete cds.
GenBankEU9662370.0EU966237.1 Zea mays clone 292756 MADS-box transcription factor 16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966424.11e-161PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-144MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLK3XZ631e-161K3XZ63_SETIT; Uncharacterized protein
STRINGSi007221m1e-161(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-67MIKC_MADS family protein